PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678448292
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family bZIP
Protein Properties Length: 174aa    MW: 19741.7 Da    PI: 9.9316
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678448292genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.71.8e-1161106550
                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                +r rr+ +NRe+ArrsR RK++ +e L+++v +++  N++L  +l 
  678448292  61 RRMRRMVSNRESARRSRMRKQKHLESLRNEVSKFKDGNRELLIKLR 106
                689************************************9998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.6E-856121IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.1459122IPR004827Basic-leucine zipper domain
PfamPF001703.5E-961118IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.4E-961134No hitNo description
SuperFamilySSF579591.85E-1061110No hitNo description
CDDcd147021.32E-1462111No hitNo description
PROSITE patternPS0003606479IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MACFPADIHG GDTLLSFDFL PPWGCYEASL QRDADFTAPV TPISASVASI TKLSGEIIDE  60
RRMRRMVSNR ESARRSRMRK QKHLESLRNE VSKFKDGNRE LLIKLRVILR QSQVILKENQ  120
SLCAEAAALR RRLSESRRDL LLQCLQETMR SSAACPCSGN VGCVNHWRLV SNHN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17380RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A103YH023e-29A0A103YH02_CYNCS; Basic-leucine zipper domain-containing protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28202251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15830.19e-17basic leucine-zipper 3